General Information

  • ID:  hor007149
  • Uniprot ID:  Q25504
  • Protein name:  Larval cuticle protein 16/17
  • Gene name:  cgbb
  • Organism:  Manduca sexta
  • Family:  NA
  • Source:  Animal
  • Expression:  Specific to the epidermis. Expressed in all the epidermal cells of day 3 larvae except for the bristle cells and those at the muscle attachment sites.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Bombycoidea (hawk-moths); Sphingidae (hawkmoths); Sphinginae (small-eyed sphinx moth); Sphingini; Manduca; Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • GO MF:  GO:0062129 chitin-based extracellular matrix
  • GO BP:  GO:0008010 structural constituent of chitin-based larval cuticle
  • GO CC:  NA

Sequence Information

  • Sequence:  EPEPPKILRSEYDQKPEGSYVFGFETEDGISRDETGEVKEALDEDNKPHSVVVVRGQYSYVDPDGNPQVIKYYADETGYHAEGDSIPKVPSRR
  • Length:  93
  • Propeptide:  MKLIILVALTLAAVVANEPEPPKILRSEYDQKPEGSYVFGFETEDGISRDETGEVKEALDEDNKPHSVVVVRGQYSYVDPDGNPQVIKYYADETGYHAEGDSIPKVPSRR
  • Signal peptide:  MKLVVAAVLAMAASRWRRLSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA